GLP-1 (Liraglutide) (3mg x 10 Vials)

$425.00

Availability: In stock Manufactured in USA

Purity: 99%

Buy GLP 1 Peptide (Liraglutide)

Buy GLP-1 USA. GLP 1 peptide is known for lowering blood sugar levels, preventing the effects of Alzheimer’s Disease, and promoting weight loss. Get GLP-1 for sale online.

FREE Shipping for orders over $200 (USA Only)

$15.00 Flat Rate Shipping Worldwide (Most Countries)

*Includes one 30mL Bacteriostatic Water with orders over $300.00

Product Description

GLP 1 Diabetes, Weight Loss, and Other Effects

GLP-1 is a peptide produced in the gut and known to lower blood sugar levels. According to research, glucagon-like peptide 1 may also improve heart, lung, and liver function while simultaneously deaccelerating the effects of Alzheimer’s Disease. Also known as Liraglutide, this peptide is also capable of decreasing the appetite by reducing intestinal mobility and deferring gastric emptying.

Currently, researchers are mainly focusing on the effects of GLP-1 peptide [i]in the realm of appetite suppression and diabetes treatment and prevention. But there is significant interest in its potential cardiovascular effects too. Further research also indicates that the GLP-1 hormone could ward off neurogenerative diseases such as Alzheimer’s Disease, another area of interest for scientific researchers.

If you are a researcher looking to buy GLP-1 for your studies, place your order today.

What is GLP 1?

GLP-1 is a short, naturally-occurring peptide made up of 30-31 amino acids. The GLP 1 sequence is: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR. And its molecular formula is: C149H226N40O45.

The primary Glp-1 function is to lower blood sugar levels by increasing insulin secretion in the body. It also promotes the insulin gene transcription which protects beta cell insulin stores. Furthermore, the peptide GLP 1 can significantly decrease appetite and improve the health of heart, muscles, liver, lungs, bones, and kidneys.

GLP1 belongs to a family of hormones known as incretins and is a product of a molecule named pre-proglucagon, a polypeptide that created glucagon and other hormones. Derived from the same source, these hormones are called “glucagon-like” because they share numerous similarities.

L-cells – cells found in the small intestine – are the primary source of GLC-1 peptide. However, it is also secreted by the pancreas and central nervous system, but in much smaller amounts.

How GLP 1 Works

Human GLP 1 is a hormone that regulates blood sugar levels and appetite. Here are the main ways it manages blood sugar levels.

  • Slows down digestion. With this process, nutrients in food are released more slowly, preventing blood sugar from spiking after eating a meal.
  • Enhances insulin production. GLP-1 enables the body make more insulin, which is released after eating, when your blood sugar level rises.
  • Prevent too much sugar from being released into the bloodstream. GLP-1 RAs reduce the amount of sugar released from the liver.

 

GLP 1 Agonists

Thanks to its involvement in blood sugar control, GLP peptide has attracted a lot of scientific attention. It’s the reason GLP-1 agonists were born. Typically, doctors prescribe such medication to those with type 2 diabetes and poor blood sugar control.

There are a variety of approved GLP 1 agonists such as:

  • Byetta/Bydureon (exenatide)
  • Tanzeum (albiglutide)
  • Trulicity (dulaglutide)
  • Victoza (liraglutide)
  • Lyxumia/Adlyxin (lixisenatide)
  • Ozempic (semaglutide injections)
  • Rybelsus (oral semaglutide)

Benefits of GLP 1 Peptide

Diabetes

The Glp-1 diabetes effects is a powerful one. According to scientists, human glucagon-like peptide creates the incretin effect, a process in which a group of metabolic hormones lower blood glucose levels in the body. GIP and GLP-1 are the two primary hormones that stimulate the effect, though GLP 1 is more potent of the two, especially in the case of high blood glucose levels.

Research shows that a GLP-1 receptor can be found on the surface of pancreatic beta cells, indicating that the peptide directly stimulates the movement of insulin from the pancreas. Further studies suggest that GLP 1 combined with sulfonylurea drugs can boost insulin secretion enough to trigger mild hypoglycemia.

Increased insulin secretion is known to increase protein synthesis, enhance amino acid uptake by the muscle, and reduce the breakdown of protein.

Research in animal subject models reveals that GLP 1 peptide hormone can arouse the growth and proliferation of pancreatic beta cells. Additional research has found that Liraglutide peptide inhibits beta cell apoptosis, suggesting that it could be effective in treating diabetes and shielding the pancreas against any effects that may harm the beta cells.

In a 2006 GLP-1 trial, investigators found that the peptide inhibited the death of beta cells caused by inflammatory cytokines. Even mouse models of type 1 diabetes displayed protected islet cells when given GLP-1 drugs, suggesting that it may prevent the onset of the disease.

Weight Loss

Many people take GLP-1 weight loss supplements to suppress the appetite and promote fat loss. However, at present, it is not FDA-approved and should only be used in medical research, due to lack of clinical trials. Still, the role of GLP 1 weight loss is an interesting one.

Research in mouse subjects found that GLP-1 administration into the brains of mice resulted in a decreased food intake. In fact, it may even enhance feelings of fullness, preventing over-consumption of food. Recent studies indicate that administration of GLP 1 peptide twice daily caused gradual weight loss and an improvement in cardiovascular health.

While Glp-1 supplements aren’t advised at present for weight loss effects, it is available to researchers interested in learning more about this peptide and its fat loss properties.

Brain

According to research, GLP-1 hormone peptide can enhance learning and protect against neurodegenerative diseases such as Alzheimer’s Disease [ii]and others. A study found that GLP-1 enhanced associative and spatial learning in mice to improve learning deficits in those with gene defects.

Further research in mice indicates that GLP 1 therapy can also protect against excitotoxic neuron damage and even stimulate neurite outgrowth in cultured cells. With additional research, scientists hope to understand more about how GLP-1 affects neurogenerative and if it can possibly stop or reverse them.

Studies on mouse models also show that GLP-1 and exendin-4 reduce levels of amyloid-beta in the brain, the primary component of the plaques found in Alzheimer’s Disease. While researchers aren’t certain that preventing amyloid beta accumulation can protect against AD, the research so far looks incredibly promising. Naturally, extensive clinical studies need to be carried out to ensure that it is safe and effective for human usage.

Cardiovascular

Recent studies show that GLP 1 receptors spread throughout the heart to improve cardiac function by increasing the heart rate and reducing LV end-diastolic pressure. LV end-diastolic pressure is largely connected to cardiac remodeling, hypertrophy, and heart failure, so reducing this pressure will have significant effects on cardiovascular health.

Scientific evidence suggests that glucagon peptide could play a vital role in lessening the damage caused by cardiac arrest. That’s because GLP1 peptide improves cardiac muscle glucose uptake, helping weaker muscle cells to function better and prevent death in the cells.

Studies on dogs indicates that a high GLP-1 dosage can enhance LV performance and decrease systematic vascular resistance, helping to reduce blood pressure and heart strain. All these effects can also lessen the long-term side effects of high blood pressure such as vascular thickening, heart failure, and LV remodeling. According to experts, GLP-1 injections administered following cardiac injury is highly beneficial in both human and animal models.

GLP 1 Side Effects

Like all drugs, taking GLP-1 may come with a risk. In this case, the biggest risk is not having enough natural GLP-1 production in the body, as this increases a person’s likelihood of obesity.

Overall, this peptide is classed as safe and risk-free. Scientists believe that GLP 1 benefits greatly outweigh the side effects, which are in fact minimal.

GLP-1 drug is not recommended for people with a family history of thyroid cancer, as studies link these hormones with thyroid tumors in rodent models.

GLP 1 Review 2020

Overall, GLP 1 shows great promise in the realm of science and pharmaceuticals as a drug that could treat a whole range of issues from diabetes to obesity to heart disease. It’s no wonder researchers are keen to get their hands on this drug.

If you read through GLP-1 reviews, you will hear a lot of positive things about this hormone protein. Research suggests it has powerful health benefits, including treating and prevent diabetes, aiding Alzheimer’s, promoting fullness to stimulate fat loss, and improve heart health.

GLP-1 Ras are extremely effectively at decreasing blood sugar levels after meals and they won’t cause hypoglycemia, unlike many medications for type 2 diabetes. While more research is needed, this group of hormones shows profound hope for people with diabetes. Research also shows that the treatment can reduce major heart problems such as heart disease and heart attacks.

At present, GLP-1 peptide buy is only available to licensed researchers. It is not for human consumption.

Where to Buy GLP 1 Peptide Online

You can get GLP-1 for sale at Peptide Sciences. They are a professional and trusted company in the field, loved by the medical community. When it comes to your research, you should only be using the highest purity products to ensure accuracy in your studies. Do not settle for anything less, as it could jeopardize your entire work. Instead, choose a company with a strong reputation in the field. Choose Peptide Sciences GLP 1.

If you would like to buy GLP-1 online USA, order directly from this company. Made in the United States, all products abide by stringent health regulations. You can expect only the best quality glucagon like peptide 1.

Buy GLP-1 1mg today, click here to buy.

 

Author info: The information provided in this article was taken from studies carried out by recognized researchers including Evers, Andreas, Torsten Haack, Martin Lorenz, Martin Bossart, Ralf Elvert, Bernd Henkel, Siegfried Stengelin, Calsolaro, Valeria, and Paul Edison.

 

References

[i] Evers, Andreas, Torsten Haack, Martin Lorenz, Martin Bossart, Ralf Elvert, Bernd Henkel, Siegfried Stengelin, et al. “Design of Novel Exendin-Based Dual Glucagon-Like Peptide 1 (GLP-1)/Glucagon Receptor Agonists.” Journal of Medicinal Chemistry 60, no. 10 (May 5, 2017): 4293–4303. doi:10.1021/acs.jmedchem.7b00174.

[ii] Calsolaro, Valeria, and Paul Edison. “Novel GLP-1 (Glucagon-Like Peptide-1) Analogues and Insulin in the Treatment for Alzheimer’s Disease and Other Neurodegenerative Diseases.” CNS Drugs 29, no. 12 (December 2015): 1023–1039. doi:10.1007/s40263-015-0301-8.

 

 

Cite this article as: Research Peptides Scientists, “GLP-1 (Liraglutide) (3mg x 10 Vials),” in ResearchPeptides.net, December 2, 2020, https://researchpeptides.net/product/peptides/glp-1-liraglutide-3mg-x-10-vials/.

 

GLP 1 Peptide Research Peptides Scientists

Product Usage: THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. This product has not been approved by the FDA for Human Use. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.

 

Additional Information

Product Brand:

PeptideSciences

Product:

GLP-1

Purity:

99%

Size:

3mg (3mg x 10 Vials)

Manufactured:

USA

Availability:

In stock

Product Price:

$425.00

Shipping USA:

FREE Shipping for orders over $200 (USA Only)

Shipping Worldwide:

$15.00 Flat Rate Shipping Worldwide (Most Countries)

Bonus:

*Includes one 30mL Bacteriostatic Water with orders over $300.00

Price Valid Until:

December 31, 2020 12:00 AM

Buy GLP-1
GLP-1 (Liraglutide) (3mg x 10 Vials)
$425.00 Buy Now